PDB entry 1x4t

View 1x4t on RCSB PDB site
Description: Solution structure of Isy1 domain in hypothetical protein
Class: RNA binding protein
Keywords: NMR, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-14, released 2005-11-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein LOC57905
    Species: Mus musculus [TaxId:10090]
    Gene: 5830446M03Rik
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D3E2 (7-85)
      • cloning artifact (0-6)
      • cloning artifact (86-91)
    Domains in SCOPe 2.08: d1x4ta1, d1x4ta2, d1x4ta3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x4tA (A:)
    gssgssgkvkerrpflasectelpkaekwrrqiigeiskkvaqiqnaglgefrirdlnde
    inkllrekghwevrikelggpdygkvsgpssg