PDB entry 1x4s

View 1x4s on RCSB PDB site
Description: Solution structure of zinc finger HIT domain in protein FON
Class: metal binding protein
Keywords: NMR, Zinc finger HIT domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2005-05-14, released 2005-11-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger HIT domain containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ZNHIT2, C11orf5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHR6 (7-52)
      • expression tag (0-6)
      • expression tag (53-58)
    Domains in SCOPe 2.06: d1x4sa1, d1x4sa2, d1x4sa3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x4sA (A:)
    gssgssgmepagpcgfcpagevqparytcprcnapycslrcyrthgtcaenfysgpssg