PDB entry 1x4r

View 1x4r on RCSB PDB site
Description: Solution structure of WWE domain in Parp14 protein
Deposited on 2005-05-14, released 2005-11-14
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Parp14 protein
    Species: Mus musculus [TaxId:10090]
    Gene: Parp14
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VDT6 (7-92)
      • cloning artifact (0-6)
      • cloning artifact (93-98)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1x4rA (A:)
    gssgssgksirlakekesqadyistyvewqyidknitqcfdkmtnmklevawkakkkdtv
    vqihnqdftvdlstntatapqgqtftvqrlvkasgpssg