PDB entry 1x4p

View 1x4p on RCSB PDB site
Description: Solution structure of SURP domain in SFRS14 protei
Class: RNA binding protein
Keywords: NMR, SURP domain, SFRS14 protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-14, released 2005-11-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative splicing factor, arginine/serine-rich 14
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IX01 (7-59)
      • cloning artifact (0-6)
      • cloning artifact (60-65)
    Domains in SCOPe 2.08: d1x4pa1, d1x4pa2, d1x4pa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x4pA (A:)
    gssgssgvgtidqlvkrviegslspkertllkedpaywflsdensleykyyklklaemqr
    sgpssg