PDB entry 1x4o

View 1x4o on RCSB PDB site
Description: Solution structure of SURP domain in splicing factor 4
Class: RNA binding protein
Keywords: NMR, SURP domain,splicing factor 4 (SF4), Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-14, released 2005-11-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: splicing factor 4
    Species: Mus musculus [TaxId:10090]
    Gene: Sf4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8CH02 (7-71)
      • cloning artifact (0-6)
      • cloning artifact (72-77)
    Domains in SCOPe 2.05: d1x4oa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1x4oA (A:)
gssgssgkvsppedeeaknlaeklarfiadggpevetialqnnrenqafsflydpnsqgy
ryyrqkldefrksgpssg