PDB entry 1x4o

View 1x4o on RCSB PDB site
Description: Solution structure of SURP domain in splicing factor 4
Class: RNA binding protein
Keywords: NMR, SURP domain,splicing factor 4 (SF4), Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-14, released 2005-11-14
The last revision prior to the SCOP 1.75 freeze date was dated 2005-11-14, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: splicing factor 4
  Species: MUS MUSCULUS
  Gene: Sf4
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8CH02 (7-71)
    • cloning artifact (0-6)
    • cloning artifact (72-77)
  Domains in SCOP 1.75: d1x4oa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x4oA (A:)
  gssgssgkvsppedeeaknlaeklarfiadggpevetialqnnrenqafsflydpnsqgy
  ryyrqkldefrksgpssg