PDB entry 1x4m

View 1x4m on RCSB PDB site
Description: Solution structure of KH domain in Far upstream element binding protein 1
Class: RNA binding protein
Keywords: NMR, KH domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-14, released 2005-11-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Far upstream element binding protein 1
  Species: Mus musculus [TaxId:10090]
  Gene: Fubp1, D3Ertd330e
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q91WJ8 (7-87)
    • cloning artifact (0-6)
    • cloning artifact (88-93)
  Domains in SCOPe 2.08: d1x4ma1, d1x4ma2, d1x4ma3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x4mA (A:)
  gssgssghgdgpgnavqeimipaskaglvigkggetikqlqeragvkmvmiqdgpqntga
  dkplritgdpykvqqakemvlelirdqgsgpssg