PDB entry 1x4k

View 1x4k on RCSB PDB site
Description: Solution structure of LIM domain in LIM-protein 3
Class: metal binding protein
Keywords: NMR, LIM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-14, released 2005-11-14
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-14, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Skeletal muscle LIM-protein 3
  Species: HOMO SAPIENS
  Gene: FHL2, DRAL, SLIM3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14192 (7-65)
    • cloning artifact (0-6)
    • cloning artifact (66-71)
  Domains in SCOP 1.73: d1x4ka1, d1x4ka2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x4kA (A:)
  gssgssgcqeckktimpgtrkmeykgsswhetcfichrcqqpigtksfipkdnqnfcvpc
  yekqhasgpssg