PDB entry 1x4k

View 1x4k on RCSB PDB site
Description: Solution structure of LIM domain in LIM-protein 3
Class: metal binding protein
Keywords: NMR, LIM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2005-05-14, released 2005-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Skeletal muscle LIM-protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: FHL2, DRAL, SLIM3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14192 (7-65)
      • cloning artifact (0-6)
      • cloning artifact (66-71)
    Domains in SCOPe 2.07: d1x4ka1, d1x4ka2, d1x4ka3, d1x4ka4
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x4kA (A:)
    gssgssgcqeckktimpgtrkmeykgsswhetcfichrcqqpigtksfipkdnqnfcvpc
    yekqhasgpssg