PDB entry 1x4j

View 1x4j on RCSB PDB site
Description: Solution structure of RING finger in RING finger protein 38
Deposited on 2005-05-14, released 2005-11-14
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RING finger protein 38
    Species: Homo sapiens [TaxId:9606]
    Gene: RNF38
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H0F5 (7-68)
      • cloning artifact (0-6)
      • cloning artifact (69-74)
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1x4jA (A:)
    gssgssgqlpsyrfnpnnhqseqtlcvvcmcdfesrqllrvlpcnhefhakcvdkwlkan
    rtcpicradsgpssg