PDB entry 1x4i

View 1x4i on RCSB PDB site
Description: Solution structure of PHD domain in inhibitor of growth protein 3 (ING3)
Class: cell adhesion
Keywords: NMR, structural genomics, PHD domain, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION
Deposited on 2005-05-14, released 2005-11-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inhibitor of growth protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: SCRIB; CRIB1; KIAA0147; LAP4; SCRB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NXR8 (7-63)
      • cloning artifact (0-6)
      • cloning artifact (64-69)
    Domains in SCOPe 2.08: d1x4ia1, d1x4ia2, d1x4ia3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x4iA (A:)
    gssgssgycicnqvsygemvgcdnqdcpiewfhygcvglteapkgkwycpqctaamkrrg
    srhksgpssg