PDB entry 1x4h

View 1x4h on RCSB PDB site
Description: Solution structure of RRM domain in RNA-binding protein 28
Class: RNA binding protein
Keywords: NMR, structural genomics, RRM domain, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-14, released 2005-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein 28
    Species: Mus musculus [TaxId:10090]
    Gene: Rbm28
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8CGC6 (7-104)
      • cloning artifact (0-6)
      • engineered (78)
      • cloning artifact (105-110)
    Domains in SCOPe 2.07: d1x4ha1, d1x4ha2, d1x4ha3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1x4hA (A:)
gssgssglpsdvtegktvfirnlsfdseeealgevlqqfgdlkyvrvvlhpdtehskgca
faqfmtqeaaqkclaaasleaeggglkldgrqlkvdlavtrdeaasgpssg