PDB entry 1x4h

View 1x4h on RCSB PDB site
Description: Solution structure of RRM domain in RNA-binding protein 28
Class: RNA binding protein
Keywords: NMR, structural genomics, RRM domain, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-14, released 2005-11-14
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-14, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein 28
    Species: MUS MUSCULUS
    Gene: Rbm28
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8CGC6 (7-104)
      • cloning artifact (0-6)
      • engineered (78)
      • cloning artifact (105-110)
    Domains in SCOP 1.73: d1x4ha1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x4hA (A:)
    gssgssglpsdvtegktvfirnlsfdseeealgevlqqfgdlkyvrvvlhpdtehskgca
    faqfmtqeaaqkclaaasleaeggglkldgrqlkvdlavtrdeaasgpssg