PDB entry 1x4h

View 1x4h on RCSB PDB site
Description: Solution structure of RRM domain in RNA-binding protein 28
Class: RNA binding protein
Keywords: NMR, structural genomics, RRM domain, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-14, released 2005-11-14
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-14, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RNA-binding protein 28
  Species: MUS MUSCULUS
  Gene: Rbm28
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8CGC6 (7-104)
    • cloning artifact (0-6)
    • engineered (78)
    • cloning artifact (105-110)
  Domains in SCOP 1.73: d1x4ha1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x4hA (A:)
  gssgssglpsdvtegktvfirnlsfdseeealgevlqqfgdlkyvrvvlhpdtehskgca
  faqfmtqeaaqkclaaasleaeggglkldgrqlkvdlavtrdeaasgpssg