PDB entry 1x4g

View 1x4g on RCSB PDB site
Description: Solution structure of RRM domain in Nucleolysin TIAR
Class: RNA binding protein
Keywords: NMR, structural genomics, RRM domain, TIA-1 related protein, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-14, released 2005-11-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleolysin TIAR
    Species: Homo sapiens [TaxId:9606]
    Gene: TIAL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01085 (7-102)
      • cloning artifact (0-6)
      • cloning artifact (103-108)
    Domains in SCOPe 2.05: d1x4ga1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x4gA (A:)
    gssgssgntkqlrfedvvnqsspknctvycggiasgltdqlmrqtfspfgqimeirvfpe
    kgysfvrfsthesaahaivsvngttieghvvkcywgkespdmtsgpssg