PDB entry 1x4f

View 1x4f on RCSB PDB site
Description: Solution structure of the second RRM domain in Matrin 3
Class: RNA binding protein
Keywords: NMR, structural genomics, RRM domain, Matrin 3, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-14, released 2005-11-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Matrin 3
  Species: Mus musculus [TaxId:10090]
  Gene: Matr3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8K310 (7-105)
    • cloning artifact (0-6)
    • cloning artifact (106-111)
  Domains in SCOPe 2.08: d1x4fa1, d1x4fa2, d1x4fa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x4fA (A:)
  gssgssgkkpegkpdqkfdqkqelgrvihlsnlphsgysdsavlklaepygkiknyilmr
  mksqafiemetredamamvdhclkkalwfqgrcvkvdlsekykklvsgpssg