PDB entry 1x4b

View 1x4b on RCSB PDB site
Description: Solution structure of RRM domain in Heterogeneous nuclear ribonucleaoproteins A2/B1
Class: RNA binding protein
Keywords: NMR, structure genomics, RRM domain, heterogeneous nuclear ribonucleoproteins A2/B1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-14, released 2005-11-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heterogeneous nuclear ribonucleoproteins A2/B1
    Species: Homo sapiens [TaxId:9606]
    Gene: HNRPA2B1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22626 (7-109)
      • cloning artifact (0-6)
      • cloning artifact (110-115)
    Domains in SCOPe 2.06: d1x4ba1, d1x4ba2, d1x4ba3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x4bA (A:)
    gssgssgmektletvplerkkrekeqfrklfigglsfetteeslrnyyeqwgkltdcvvm
    rdpaskrsrgfgfvtfssmaevdaamaarphsidgrvvepkravareesgsgpssg