PDB entry 1x49

View 1x49 on RCSB PDB site
Description: Solution structure of the first DSRM domain in Interferon-induced, double-stranded RNA-activated protein kinase
Class: RNA binding protein
Keywords: NMR, structure genomics, DSRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-14, released 2005-11-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon-induced, double-stranded RNA-activated protein kinase
    Species: Mus musculus [TaxId:10090]
    Gene: Prkr, Eif2ak2, Pkr, Tik
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03963 (7-90)
      • cloning artifact (0-6)
      • cloning artifact (91-96)
    Domains in SCOPe 2.06: d1x49a1, d1x49a2, d1x49a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x49A (A:)
    gssgssgmasdtpgfymdklnkyrqmhgvaitykelstsgpphdrrftfqvlidekefpe
    akgrskqearnaaaklavdildnenkvdchtsgpssg