PDB entry 1x48

View 1x48 on RCSB PDB site
Description: Solution structure of the second DSRM domain in Interferon-induced, double-stranded RNA-activated protein kinase
Class: RNA binding protein
Keywords: NMR, structure genomics, DSRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-14, released 2005-11-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Interferon-induced, double-stranded RNA-activated protein kinase
  Species: Mus musculus [TaxId:10090]
  Gene: Prkr, Eif2ak2, Pkr, Tik
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q03963 (7-81)
    • cloning artifact (0-6)
    • cloning artifact (82-87)
  Domains in SCOPe 2.06: d1x48a1, d1x48a2, d1x48a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x48A (A:)
  gssgssgyiglvnsfaqkkklsvnyeqcepnselpqrfickckigqtmygtgsgvtkqea
  kqlaakeayqkllksppktagtsgpssg