PDB entry 1x47

View 1x47 on RCSB PDB site
Description: Solution structure of DSRM domain in DGCR8 protein
Class: RNA binding protein
Keywords: NMR, structural genomics, DSRM domain, DGCR8 protein, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-14, released 2005-11-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DGCR8 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: DGCR8, DGCRK6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WYQ5 (7-91)
      • cloning artifact (0-6)
      • cloning artifact (92-97)
    Domains in SCOPe 2.08: d1x47a1, d1x47a2, d1x47a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1x47A (A:)
gssgssgefvinpngksevcilheymqrvlkvrpvynffecenpsepfgasvtidgvtyg
sgtasskklaknkaaratleilipdfvkqtsesgpssg