PDB entry 1x46

View 1x46 on RCSB PDB site
Description: Crystal structure of a hemoglobin component (TA-VII) from Tokunagayusurika akamusi
Class: oxygen storage/transport
Keywords: hemoglobin, Diptera, Tokunagayusurika akamusi, midge larva, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2005-05-14, released 2005-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.194
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hemoglobin component VII
  Species: Tokunagayusurika akamusi [TaxId:28383]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7M421 (0-149)
  Domains in SCOPe 2.07: d1x46a_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x46A (A:)
  dptwvdmeagdialvksswaqihdkevdilynffksypasqakfsafagkdleslkdtap
  falhatrivsvineaialmgvaenrpalknvlkqqginhkgrgvtaahfeefetaleafl
  eshasgynagtkkawdsafnnmysvvfpel