PDB entry 1x46

View 1x46 on RCSB PDB site
Description: Crystal structure of a hemoglobin component (TA-VII) from Tokunagayusurika akamusi
Class: oxygen storage/transport
Keywords: hemoglobin, Diptera, Tokunagayusurika akamusi, midge larva, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2005-05-14, released 2005-05-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.194
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin component VII
    Species: Tokunagayusurika akamusi [TaxId:28383]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1x46a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x46A (A:)
    dptwvdmeagdialvksswaqihdkevdilynffksypasqakfsafagkdleslkdtap
    falhatrivsvineaialmgvaenrpalknvlkqqginhkgrgvtaahfeefetaleafl
    eshasgynagtkkawdsafnnmysvvfpel