PDB entry 1x45

View 1x45 on RCSB PDB site
Description: Solution structure of the first PDZ domain of amyloid beta A4 precursor protein-binding family A, member 1
Class: endocytosis/exocytosis
Keywords: PDZ domain, Amyloid beta A4 precursor protein-binding family A, member 1, Neuron-specific XII protein, Adapter protein XII alpha, Neuronal Munc 18-1-interacting protein 1 Mint-1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-13, released 2005-11-13
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-13, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: amyloid beta (A4) precursor protein-binding, family A, member 1 (X11)
  Species: HOMO SAPIENS
  Gene: APBA1, MINT1, X11
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02410 (7-91)
    • cloning artifact (0-6)
    • cloning artifact (92-97)
  Domains in SCOP 1.73: d1x45a1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x45A (A:)
  gssgssgdvfiekqkgeilgvvivesgwgsilptviianmmhggpaeksgklnigdqims
  ingtslvglplstcqsiikglknqsrvklnivsgpssg