PDB entry 1x45

View 1x45 on RCSB PDB site
Description: Solution structure of the first PDZ domain of amyloid beta A4 precursor protein-binding family A, member 1
Class: endocytosis/exocytosis
Keywords: PDZ domain, Amyloid beta A4 precursor protein-binding family A, member 1, Neuron-specific XII protein, Adapter protein XII alpha, Neuronal Munc 18-1-interacting protein 1 Mint-1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2005-05-13, released 2005-11-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amyloid beta (A4) precursor protein-binding, family A, member 1 (X11)
    Species: Homo sapiens [TaxId:9606]
    Gene: APBA1, MINT1, X11
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02410 (7-91)
      • cloning artifact (0-6)
      • cloning artifact (92-97)
    Domains in SCOPe 2.08: d1x45a1, d1x45a2, d1x45a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x45A (A:)
    gssgssgdvfiekqkgeilgvvivesgwgsilptviianmmhggpaeksgklnigdqims
    ingtslvglplstcqsiikglknqsrvklnivsgpssg