PDB entry 1x43

View 1x43 on RCSB PDB site
Description: Solution structure of the SH3 domain of Endophilin B1 (Sh3g1b1)
Class: endocytosis/exocytosis
Keywords: SH3 domain, GRB2-like protein B1, Endophilin B1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2005-05-13, released 2005-11-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: SH3 domain GRB2-like protein B1
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA library 4930422M04
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9JK48 (7-74)
    • cloning artifact (0-6)
    • cloning artifact (75-80)
  Domains in SCOPe 2.05: d1x43a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x43A (A:)
  gssgssglndlkessnnrkarvlydydaanstelslladevitvfsvvgmdsdwlmgerg
  nqkgkvpitylellnsgpssg