PDB entry 1x42

View 1x42 on RCSB PDB site
Description: Crystal structure of a haloacid dehalogenase family protein (PH0459) from Pyrococcus horikoshii OT3
Class: hydrolase
Keywords: haloacid dehalogenase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, hydrolase
Deposited on 2005-05-12, released 2005-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.166
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PH0459
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58216 (0-End)
      • modified residue (0)
      • modified residue (26)
      • modified residue (71)
      • modified residue (93)
      • modified residue (119)
      • modified residue (129)
      • modified residue (193)
    Domains in SCOPe 2.07: d1x42a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x42A (A:)
    miravffdfvgtllsvegeakthlkimeevlgdyplnpktlldeyekltreafsnyagkp
    yrpirdieeevmrklaekygfkypenfweihlrmhqrygelypevvevlkslkgkyhvgm
    itdsdteylmahldalgikdlfdsittseeagffkphprifelalkkagvkgeeavyvgd
    npvkdcggsknlgmtsilldrkgekrefwdkcdfivsdlrevikivdelngq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x42A (A:)
    miravffdfvgtllsvegeakthlkimeevlgdyplnpktlldeyekltreafsnyagkp
    yrpirdieeevmrklaekygfkypenfweihlrmhqrygelypevvevlkslkgkyhvgm
    itdsdteylmahldalgikdlfdsittseeagffkphprifelalkkagvkgeeavyvgd
    npvkdcggsknlgmtsilldrkgekrefwdkcdfivsdlrevikivdeln