PDB entry 1x3x

View 1x3x on RCSB PDB site
Description: Crystal Structure of Cytochrome b5 from Ascaris suum
Class: electron transport
Keywords: cytochrome b5, hemoprotein, porcine parasitic namatode, ELECTRON TRANSPORT
Deposited on 2005-05-11, released 2006-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome b5
  Species: Ascaris suum [TaxId:6253]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q17091 (0-81)
  Domains in SCOPe 2.08: d1x3xa_
• Chain 'B':
  Compound: cytochrome b5
  Species: Ascaris suum [TaxId:6253]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q17091 (0-81)
  Domains in SCOPe 2.08: d1x3xb_
• Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x3xA (A:)
  cgdkkytkeevakhntqndlwiiydgevhdmtsfykehpggkvilnkagqdatsvlktla
  phvkaadvvmkklkqtcigkvk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x3xB (B:)
  cgdkkytkeevakhntqndlwiiydgevhdmtsfykehpggkvilnkagqdatsvlktla
  phvkaadvvmkklkqtcigkvk