PDB entry 1x3w

View 1x3w on RCSB PDB site
Description: Structure of a peptide:N-glycanase-Rad23 complex
Class: hydrolase
Keywords: Protein-protein complex, HYDROLASE
Deposited on 2005-05-11, released 2005-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.245
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptide:N-glycanase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02890 (0-End)
      • modified residue (10)
      • modified residue (132)
      • modified residue (247)
    Domains in SCOPe 2.07: d1x3wa1
  • Chain 'B':
    Compound: UV excision repair protein RAD23
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32628 (Start-71)
      • modified residue (57)
      • modified residue (66)
    Domains in SCOPe 2.07: d1x3wb1
  • Heterogens: SUC, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x3wA (A:)
    nnidfdsiakmllikykdfilskfkkaapvenirfqnlvhtnqfaqgvlgqsqhlctvyd
    npswhsivletldldliyknvdkefakdghaegeniytdylvkellryfkqdffkwcnkp
    dcnhcgqntsenmtplgsqgpngeeskfncgtveiykcnrcgnitrfpryndpiklletr
    kgrcgewcnlftlilksfgldvryvwnredhvwceyfsnflnrwvhvdsceqsfdqpyiy
    sinwnkkmsyciafgkdgvvdvskryilqnelprdqikeedlkflcqfitkrlryslndd
    eiyqlacrdeqeqielirgktqetksesvsaasks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x3wA (A:)
    nnidfdsiakmllikykdfilskfkkaapvenirfqnlvhtnqfaqgvlgqsqhlctvyd
    npswhsivletldldliyknvdkefakdghaegeniytdylvkellryfkqdffkwcnkp
    dcnhcgqntsenmtplgsqgpngeeskfncgtveiykcnrcgnitrfpryndpiklletr
    kgrcgewcnlftlilksfgldvryvwnredhvwceyfsnflnrwvhvdsceqsfdqpyiy
    sinwnkkmsyciafgkdgvvdvskryilqnelprdqikeedlkflcqfitkrlryslndd
    eiyqlacrdeqeqielirgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x3wB (B:)
    gttggatdaaqggppgsigltvedllslrqvvsgnpealapllenisarypqlrehiman
    pevfvsmlleav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x3wB (B:)
    gsigltvedllslrqvvsgnpealapllenisarypqlrehimanpevfvsmlleav