PDB entry 1x3v

View 1x3v on RCSB PDB site
Description: Solution structure of the 1st SH3 domain from human neutrophil cytosol factor 2 (NCF-2)
Class: signaling protein
Keywords: SH3 domain, Neutrophil cytosol factor, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-10, released 2005-11-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2006-05-02, with a file datestamp of 2007-06-01.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: neutrophil cytosol factor 2
  Species: HOMO SAPIENS
  Gene: NCF2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19878 (7-61)
    • cloning artifact (0-6)
    • cloning artifact (62-67)
  Domains in SCOPe 2.08: d1x3va1, d1x3va2, d1x3va3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x3vA (A:)
  gssgssgeahrvlfgfvpetkeelqvmpgnivfvlkkgndnwatvmfngqkglvpcnyle
  pvsgpssg