PDB entry 1x3u

View 1x3u on RCSB PDB site
Description: Solution structure of the C-terminal transcriptional activator domain of FixJ from Sinorhizobium melilot
Deposited on 2005-05-10, released 2006-05-02
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulatory protein fixj
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: fixJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10958 (4-78)
      • cloning artifact (0-3)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1x3uA (A:)
    gshmddandirarlqtlsererqvlsavvaglpnksiaydldisprtvevhranvmakmk
    akslphlvrmalaggfgps