PDB entry 1x3q

View 1x3q on RCSB PDB site
Description: 3D Solution Structure of the Chromo-2 Domain of cpSRP43
Class: unknown function
Keywords: Chromo-2 domain, cpSRP43, LHCP, thylakoid, protein translocation, unknown function
Deposited on 2005-05-10, released 2005-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cpSRP43
  Species: Arabidopsis thaliana [TaxId:3702]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O22265 (2-56)
    • cloning artifact (0-1)
  Domains in SCOPe 2.08: d1x3qa1, d1x3qa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x3qA (A:)
  gsqvfeyaevdeivekrgkgkdveylvrwkdggdcewvkgvhvaedvakdyedgley