PDB entry 1x3m

View 1x3m on RCSB PDB site
Description: Crystal structure of ADP bound Propionate kinase (TdcD) from Salmonella typhimurium
Class: transferase
Keywords: Propionate Kinase, TdcD, ADP, L-threonine metabolism, Propionate Metabolism, Transferase
Deposited on 2005-05-09, released 2005-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Propionate kinase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: tdcD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x3ma1, d1x3ma2
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x3mA (A:)
    mrgshhhhhhgmasnefpvvlvincgsssikfsvldvatcdvlmagiadgmntenaflsi
    ngdkpinlahsnyedalkaiafelekrdltdsvalighriahggelftqsviitdeiidn
    irrvsplaplhnyanlsgidaarhlfpavrqvavfdtsfhqtlapeaylyglpweyfssl
    gvrrygfhgtshryvsrrayelldldekdsglivahlgngasicavrngqsvdtsmgmtp
    leglmmgtrsgdvdfgamawiaketgqtlsdlervvnkesgllgisglssdlrvlekawh
    egherarlaiktfvhriarhiaghaaslhrldgiiftggigensvlirqlviehlgvlgl
    tldvemnkqpnshgeriisanpsqvicaviptneekmialdaihlgnvkapvefa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x3mA (A:)
    fpvvlvincgsssikfsvldvatcdvlmagiadgmntenaflsingdkpinlahsnyeda
    lkaiafelekrdltdsvalighriahggelftqsviitdeiidnirrvsplaplhnyanl
    sgidaarhlfpavrqvavfdtsfhqtlapeaylyglpweyfsslgvrrygfhgtshryvs
    rrayelldldekdsglivahlgngasicavrngqsvdtsmgmtpleglmmgtrsgdvdfg
    amawiaketgqtlsdlervvnkesgllgisglssdlrvlekawhegherarlaiktfvhr
    iarhiaghaaslhrldgiiftggigensvlirqlviehlgvlgltldvemnkqpnshger
    iisanpsqvicaviptneekmialdaihlgnvka