PDB entry 1x3l

View 1x3l on RCSB PDB site
Description: Crystal structure of the PH0495 protein from pyrococccus horikoshii OT3
Class: Transferase
Keywords: structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, Transferase
Deposited on 2005-05-09, released 2006-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.199
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PH0495
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x3la_
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x3lA (A:)
    miamdireiglrlvgeaikaadpyravlnavkvsddkiivqgkefeikgkvyvialgkaa
    cemaraiedildvedgvavtkygygkelkrikvieaghpipdeksilgakealsilnrar
    endivfilisgggsalfelpeegisledlklttdlllksgakiheintvrkhiskvkggk
    lakmikgtgivliisdvvgdnleaiasgptvkdpttfedakrilelydiwekvpesvrlh
    ierglrgeveetlkedlpnvhnfliasnsisceaiareaqrlgfkayimtttlegeakda
    glfigsivqeiaergrpfeppvvlvfggettvtiegkggkggpnqeialsatrkisdlea
    livafdtdgtdgptdaaggivdgttykklrekgidvekvlkehnsyealkkvggllftgp
    tgtnvnsiviaivtskrgrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x3lA (A:)
    miamdireiglrlvgeaikaadpyravlnavkvsddkiivqgkefeikgkvyvialgkaa
    cemaraiedildvedgvavtkygygkelkrikvieaghpipdeksilgakealsilnrar
    endivfilisgggsalfelpeegisledlklttdlllksgakiheintvrkhiskvkggk
    lakmikgtgivliisdvvgdnleaiasgptvkdpttfedakrilelydiwekvpesvrlh
    ierglrgeveetlkedlpnvhnfliasnsisceaiareaqrlgfkayimtttlegeakda
    glfigsivqeiaergrpfeppvvlvfggettvtiegkggkggpnqeialsatrkisdlea
    livafdtdgtdgptdaaggivdgttykklrekgidvekvlkehnsyealkkvggllftgp
    tgtnvnsiviaivtsk