PDB entry 1x3h

View 1x3h on RCSB PDB site
Description: Solution structure of the LIM domain of human Leupaxin
Class: metal binding protein
Keywords: Leupaxin, Paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2005-05-09, released 2005-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leupaxin
    Species: Homo sapiens [TaxId:9606]
    Gene: LPXN
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60711 (7-73)
      • cloning artifact (0-6)
      • cloning artifact (74-79)
    Domains in SCOPe 2.07: d1x3ha1, d1x3ha2, d1x3ha3, d1x3ha4
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1x3hA (A:)
gssgssgkdflamfspkcggcnrpvlenylsamdtvwhpecfvcgdcftsfstgsffeld
grpfcelhyhhrrgsgpssg