PDB entry 1x3e

View 1x3e on RCSB PDB site
Description: Crystal structure of the single-stranded DNA-binding protein from Mycobacterium smegmatis
Class: DNA binding protein
Keywords: oligonucleotide binding fold, DNA-binding protein, DNA BINDING PROTEIN
Deposited on 2005-05-04, released 2005-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.202
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-strand binding protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x3ea_
  • Chain 'B':
    Compound: Single-strand binding protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x3eb_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x3eA (A:)
    magdttitvvgnltadpelrftpsgaavanftvastprmfdrqsgewkdgealflrcniw
    reaaenvaesltrgsrvivtgrlkqrsfetregekrtvvevevdeigpslryatakvnka
    srsggggggfgsggggsrqsepkddpwgsapasgsfsgaddeppf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x3eA (A:)
    gdttitvvgnltadpelrftpsgaavanftvastprmewkdgealflrcniwreaaenva
    esltrgsrvivtgrlkqrsfetrekrtvvevevdeigpslryatakvnka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x3eB (B:)
    magdttitvvgnltadpelrftpsgaavanftvastprmfdrqsgewkdgealflrcniw
    reaaenvaesltrgsrvivtgrlkqrsfetregekrtvvevevdeigpslryatakvnka
    srsggggggfgsggggsrqsepkddpwgsapasgsfsgaddeppf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x3eB (B:)
    agdttitvvgnltadpelrftpsgaavanftvastprmfdrqsgewkdgealflrcniwr
    eaaenvaesltrgsrvivtgrlkqrsfetregekrtvvevevdeigpslryatakvnka