PDB entry 1x3d

View 1x3d on RCSB PDB site
Description: Solution structure of the fibronectin type-III domain of human fibronectin type-III domain containing protein 3a
Class: structural genomics, unknown function
Keywords: Fibronectin type III domain containing protein, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-05-02, released 2005-11-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fibronectin type-III domain containing protein 3a
  Species: Homo sapiens [TaxId:9606]
  Gene: FNDC3A
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y2H6 (7-111)
    • cloning artifact (0-6)
    • cloning artifact (112-117)
  Domains in SCOPe 2.08: d1x3da1, d1x3da2, d1x3da3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x3dA (A:)
  gssgssgaeifttlscepdipnpprianrtknsltlqwkapsdngskiqnfvlewdegkg
  ngefcqcymgsqkqfkitklspamgckfrlsarndygtsgfseevlyytsgcsgpssg