PDB entry 1x3c

View 1x3c on RCSB PDB site
Description: Solution structure of the C2H2 type zinc-binding domain of human zinc finger protein 292
Class: DNA binding protein
Keywords: DNA binding, Nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-02, released 2005-11-02
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-17, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein 292
    Species: HOMO SAPIENS
    Gene: ZNF292
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60281 (7-66)
      • cloning artifact (0-6)
      • cloning artifact (67-72)
    Domains in SCOP 1.73: d1x3ca1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x3cA (A:)
    gssgssgrkkpvsqslefptryspyrpyrcvhqgcfaaftiqqnlilhyqavhksdlpaf
    saeveeesgpssg