PDB entry 1x3c

View 1x3c on RCSB PDB site
Description: Solution structure of the C2H2 type zinc-binding domain of human zinc finger protein 292
Class: DNA binding protein
Keywords: DNA binding, Nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2005-05-02, released 2005-11-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Zinc finger protein 292
  Species: Homo sapiens [TaxId:9606]
  Gene: ZNF292
  Database cross-references and differences (RAF-indexed):
  • Uniprot O60281 (7-66)
    • cloning artifact (0-6)
    • cloning artifact (67-72)
  Domains in SCOPe 2.08: d1x3ca1, d1x3ca2, d1x3ca3
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x3cA (A:)
  gssgssgrkkpvsqslefptryspyrpyrcvhqgcfaaftiqqnlilhyqavhksdlpaf
  saeveeesgpssg