PDB entry 1x3b

View 1x3b on RCSB PDB site
Description: Solution structure of the FAS1 domain of human transforming growth factor-beta induced protein IG-H3
Deposited on 2005-05-02, released 2005-11-02
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transforming growth factor-beta induced protein IG-H3
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFBI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15582 (7-139)
      • cloning artifact (0-6)
      • cloning artifact (140-145)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1x3bA (A:)
    gssgssgmgtvmdvlkgdnrfsmlvaaiqsagltetlnregvytvfaptneafralppre
    rsrllgdakelanilkyhigdeilvsggigalvrlkslqgdklevslknnvvsvnkepva
    epdimatngvvhvitnvlqpsgpssg