PDB entry 1x3a

View 1x3a on RCSB PDB site
Description: Solution structure of the BSD domain of human Synapse associated protein 1
Class: structural genomics,unknown function
Keywords: Synapse associated protein 1, BSD domain, Homolog of the drosophila SAP47, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL GENOMICS,UNKNOWN FUNCTION
Deposited on 2005-05-02, released 2005-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synapse associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SYAP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96A49 (7-93)
      • cloning artifact (0-6)
      • cloning artifact (94-99)
    Domains in SCOPe 2.07: d1x3aa1, d1x3aa2, d1x3aa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x3aA (A:)
    gssgssgtndeetiqqqilalsadkrnflrdppagvqfnfdfdqmypvalvmlqedells
    kmrfalvpklvkeevfwrnyfyrvslikqsaqltsgpssg