SCOP: Structural Classification of Proteins and ASTRAL

Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)

PDB entry 1x3a

View 1x3a on RCSB PDB site
Description: Solution structure of the BSD domain of human Synapse associated protein 1
Class: structural genomics,unknown function
Keywords: Synapse associated protein 1, BSD domain, Homolog of the drosophila SAP47, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL GENOMICS,UNKNOWN FUNCTION
Deposited on 2005-05-02, released 2005-11-02
The last revision prior to the SCOP 1.75B freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Synapse associated protein 1
Species: Homo sapiens [TaxId:9606]
Gene: SYAP1
Domains in SCOP 1.75B: d1x3aa1

PDB Chain Sequences:

Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)

>1x3aA (A:)
gssgssgtndeetiqqqilalsadkrnflrdppagvqfnfdfdqmypvalvmlqedells
kmrfalvpklvkeevfwrnyfyrvslikqsaqltsgpssg