PDB entry 1x39

View 1x39 on RCSB PDB site
Description: Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole
Class: hydrolase
Keywords: 2-domain fold, ligand-protein complex
Deposited on 2005-05-02, released 2005-12-20
The last revision prior to the SCOP 1.73 freeze date was dated 2005-12-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.16
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-D-glucan exohydrolase isoenzyme ExoI
    Species: HORDEUM VULGARE
    Database cross-references and differences (RAF-indexed):
    • GB AAD23382 (0-601)
      • see remark 999 (319)
    Domains in SCOP 1.73: d1x39a1, d1x39a2
  • Heterogens: SO4, IDE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x39A (A:)
    dyvlykdatkpvedrvadllgrmtlaekigqmtqierlvatpdvlrdnfigsllsgggsv
    prkgatakewqdmvdgfqkacmstrlgipmiygidavhgqnnvygatifphnvglgatrd
    pylvkrigeatalevratgiqyafapciavcrdprwgrcyesysedrrivqsmtelipgl
    qgdvpkdftsgmpfvagknkvaacakhfvgdggtvdginenntiinreglmnihmpaykn
    amdkgvstvmisysswngvkmhanqdlvtgylkdtlkfkgfvisdwegidrittpagsdy
    sysvkasilagldmimvpnkyqqfisiltghvnggvipmsriddavtrilrvkftmglfe
    npyadpamaeqlgkqehrdlareaarkslvllkngktstdapllplpkkapkilvagsha
    dnlgyqcggwtiewqgdtgrttvgttileavkaavdpstvvvfaenpdaefvksggfsya
    ivavgehpytetkgdnlnltipepglstvqavcggvrcatvlisgrpvvvqpllaasdal
    vaawlpgsegqgvtdalfgdfgftgrlprtwfksvdqlpmnvgdahydplfrlgyglttn
    at