PDB entry 1x36

View 1x36 on RCSB PDB site
Description: T=1 capsid of an amino-terminal deletion mutant of SeMV CP
Class: Virus
Keywords: T=1 capsid, N-ARM, Icosahedral virus
Deposited on 2005-04-29, released 2005-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.245
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x36a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x36A (A:)
    rrrqrsavqqlqptqagismapsaqgamvrirnpavsssrggitvlthselsaeigvtds
    ivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtv
    pvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsa
    dyatavgvdvniatplvparlvialldgssstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x36A (A:)
    rggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyips
    cpsstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtsta
    isttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagri
    yctytiqmieptasalnn