PDB entry 1x35

View 1x35 on RCSB PDB site
Description: Recombinant T=3 capsid of a site specific mutant of SeMV CP
Deposited on 2005-04-29, released 2005-10-18
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 4.1 Å
R-factor: 0.268
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: coat protein
    Species: Sesbania mosaic virus [TaxId:12558]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EB06 (Start-267)
      • engineered (52)
  • Heterogens: CA

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1x35A (A:)
    makrlskqqlakaiantletppqpkagrrrnrrrqrsavqqlqptqagismaasaqgamv
    rirnpavsssrggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskysw
    lsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfin
    gtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgs
    sstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records):
    >1x35A (A:)
    gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
    sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
    ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
    tytiqmieptasalnn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1x35B (B:)
    makrlskqqlakaiantletppqpkagrrrnrrrqrsavqqlqptqagismaasaqgamv
    rirnpavsssrggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskysw
    lsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfin
    gtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgs
    sstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records):
    >1x35B (B:)
    ggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipsc
    psstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstai
    sttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriy
    ctytiqmieptasalnn
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1x35C (C:)
    makrlskqqlakaiantletppqpkagrrrnrrrqrsavqqlqptqagismaasaqgamv
    rirnpavsssrggitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskysw
    lsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfin
    gtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgs
    sstavaagriyctytiqmieptasalnn
    

    Sequence, based on observed residues (ATOM records):
    >1x35C (C:)
    ptqagismaasaqgamvrirnpavsssrggitvlthselsaeigvtdsivvsselvmpyt
    vgtwlrgvaanwskyswlsvrytyipscpsstagsihmgfqydmadtvpvsvnqlsnlrg
    yvsgqvwsgsaglcfingtrcsdtstaisttldvsklgkkwypyktsadyatavgvdvni
    atplvparlvialldgssstavaagriyctytiqmieptasalnn