PDB entry 1x2w

View 1x2w on RCSB PDB site
Description: Crystal Structure of Apo-Habu IX-bp at pH 4.6
Class: protein binding
Keywords: heterodimer, domain swapping, c-type lectin-like protein, protein binding
Deposited on 2005-04-26, released 2005-10-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.214
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coagulation factor IX/X-binding protein A chain
    Species: Trimeresurus flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1x2wa_
  • Chain 'B':
    Compound: Coagulation factor IX/factor X-binding protein B chain
    Species: Trimeresurus flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1x2wb_
  • Heterogens: CL, RB, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x2wA (A:)
    dcpsgwssyeghcykpfklyktwddaerfcteqakgghlvsiesageadfvaqlvteniq
    ntksyvwiglrvqgkekqcssewsdgssvsyenwieaesktclgleketgfrkwvniycg
    qqnpfvcea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x2wB (B:)
    dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
    hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
    fqa