PDB entry 1x2w

View 1x2w on RCSB PDB site
Description: Crystal Structure of Apo-Habu IX-bp at pH 4.6
Class: protein binding
Keywords: heterodimer, domain swapping, c-type lectin-like protein
Deposited on 2005-04-26, released 2005-10-04
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.214
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Coagulation factor IX/X-binding protein A chain
  Species: Trimeresurus flavoviridis
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7LZ71 (0-128)
  Domains in SCOP 1.73: d1x2wa1
• Chain 'B':
  Compound: Coagulation factor IX/factor X-binding protein B chain
  Species: Trimeresurus flavoviridis
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23807 (0-122)
  Domains in SCOP 1.73: d1x2wb1
• Heterogens: CL, RB, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x2wA (A:)
  dcpsgwssyeghcykpfklyktwddaerfcteqakgghlvsiesageadfvaqlvteniq
  ntksyvwiglrvqgkekqcssewsdgssvsyenwieaesktclgleketgfrkwvniycg
  qqnpfvcea
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x2wB (B:)
  dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
  hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
  fqa