PDB entry 1x2q

View 1x2q on RCSB PDB site
Description: Solution structure of the SH3 domain of the Signal transducing adaptor molecule 2
Class: signaling protein
Keywords: SH3 domain, Signal transducing adaptor molecule, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-04-26, released 2005-10-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Signal transducing adapter molecule 2
    Species: Homo sapiens [TaxId:9606]
    Gene: STAM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75886 (7-81)
      • cloning artifact (0-6)
      • cloning artifact (82-87)
    Domains in SCOPe 2.06: d1x2qa1, d1x2qa2, d1x2qa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x2qA (A:)
    gssgssgseiqlnnkvarkvralydfeavedneltfkhgeiiivlddsdanwwkgenhrg
    iglfpsnfvttnlnieteaaavsgpssg