PDB entry 1x2p

View 1x2p on RCSB PDB site
Description: Solution structure of the SH3 domain of the Protein arginine N-methyltransferase 2
Class: transferase
Keywords: SH3 domain, Protein arginine N-methyltransferase, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-04-26, released 2005-10-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein arginine N-methyltransferase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HRMT1L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55345 (7-61)
      • cloning artifact (0-6)
      • cloning artifact (62-67)
    Domains in SCOPe 2.05: d1x2pa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x2pA (A:)
    gssgssgeefvaiadyaatdetqlsflrgekililrqttadwwwgeragccgyipanhvg
    khsgpssg