PDB entry 1x2n

View 1x2n on RCSB PDB site
Description: Solution structure of the homeobox domain of human homeobox protein PKNOX1
Class: transcription
Keywords: homeobox domain, human homeobox protein PKNOX1, structural genomics , NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-04-26, released 2005-10-26
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-26, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox protein PKNOX1
    Species: HOMO SAPIENS
    Gene: PKNOX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55347 (7-66)
      • cloning artifact (0-6)
      • cloning artifact (67-72)
    Domains in SCOP 1.73: d1x2na1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x2nA (A:)
    gssgssgknkrgvlpkhatnvmrswlfqhighpyptedekkqiaaqtnltllqvnnwfin
    arrrilqsgpssg