PDB entry 1x2n

View 1x2n on RCSB PDB site
Description: Solution structure of the homeobox domain of human homeobox protein PKNOX1
Class: transcription
Keywords: homeobox domain, human homeobox protein PKNOX1, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2005-04-26, released 2005-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox protein PKNOX1
    Species: Homo sapiens [TaxId:9606]
    Gene: PKNOX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55347 (7-66)
      • cloning artifact (0-6)
      • cloning artifact (67-72)
    Domains in SCOPe 2.07: d1x2na1, d1x2na2, d1x2na3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x2nA (A:)
    gssgssgknkrgvlpkhatnvmrswlfqhighpyptedekkqiaaqtnltllqvnnwfin
    arrrilqsgpssg