PDB entry 1x2l

View 1x2l on RCSB PDB site
Description: Solution structure of the CUT domain of human homeobox protein Cux-2 (Cut-like 2)
Class: transcription
Keywords: CUT domain, human homeobox protein Cux-2, Cut-like 2, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2005-04-26, released 2005-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox protein Cux-2
    Species: Homo sapiens [TaxId:9606]
    Gene: CUTL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14529 (7-94)
      • cloning artifact (0-6)
      • cloning artifact (95-100)
    Domains in SCOPe 2.08: d1x2la1, d1x2la2, d1x2la3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1x2lA (A:)
gssgssgagpgaeeeqldtaeiafqvkeqllkhnigqrvfghyvlglsqgsvseilarpk
pwrkltvkgkepfikmkqflsdeqnvlalrtiqvrsgpssg